PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 334aa    MW: 35908.7 Da    PI: 9.7576
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-3879137361
   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
              e alkcprCds ntkfCyynny+l+qPryfCkaCrryWt+GGalrnvPvGgg+rkn k+
  RrC8_p1  79 EGALKCPRCDSINTKFCYYNNYNLTQPRYFCKACRRYWTRGGALRNVPVGGGCRKNSKK 137
              5689****************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3064132IPR003851Zinc finger, Dof-type
PfamPF027015.9E-3381136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31182136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVFSSNWSQP TNPNNHQHQL HENGSLVSDH GLLSHQLPPC PPNPNPNHHY AAATASGLPA  60
RLGGSMAERA RQAKAPPPEG ALKCPRCDSI NTKFCYYNNY NLTQPRYFCK ACRRYWTRGG  120
ALRNVPVGGG CRKNSKKGKN SNSKSSSSLS KQSSSTVNAP SSNSGQLRTN HQFPFLPTIH  180
NLTQLGGIGL NLAATSGNNQ GHQIGSSLMN DLGFLHVGNG RNIHDNNNNG SINNLMASAG  240
SLSHFALFDP TTGLHAFQNE GNILNNVGIS FSSTSMVDSR AYQAAPVKME EQPGLVNLSR  300
PVSGLTSPGN QTNQYLWNSS DFSGPSSNDH HQLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842850.0FJ584285.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110927.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
RefseqXP_009111221.10.0PREDICTED: dof zinc finger protein DOF1.1-like
RefseqXP_013605819.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X2
SwissprotQ8L9V61e-157DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLM4EPH60.0M4EPH6_BRARP; Uncharacterized protein
STRINGBra030696.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-144Dof family protein